PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011095199.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 329aa    MW: 34738.7 Da    PI: 9.8554
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011095199.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.6e-3963122362
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     e+alkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  XP_011095199.1  63 ETALKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 122
                     7789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3446115IPR003851Zinc finger, Dof-type
PfamPF027019.9E-3365120IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.60966120IPR003851Zinc finger, Dof-type
PROSITE patternPS01361068104IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MVDQQNHQII GSSGANPLLP PPSQPGPPPP PPPPQPHGGG GAGSIRPGSM AERARLANIP  60
MPETALKCPR CESTNTKFCY FNNYSLSQPR HFCKTCRRYW TRGGALRNVP VGGGCRRNKR  120
SKSTSSKSPA SSDRQTNPSS TSNNNMSTNS GTANILGLTP QLPPLRFMSP LSQLTDNFTS  180
DMGLNFSGIS APAVGTNEMN FHGASNLLGG AGGVASLLSS SGGGIESWRL QQVQQFPFLG  240
GLEASPSGIY QFQGGESAGF MGGETSHQMR PKLSSSMLNQ RSSSVKMEEN PAEANLSRQL  300
LGGMGEQWNT STAWTELSSF SSSSTSNAL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00483DAPTransfer from AT5G02460Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095199.10.0PREDICTED: dof zinc finger protein DOF5.1
SwissprotQ9LZ563e-57DOF51_ARATH; Dof zinc finger protein DOF5.1
TrEMBLA0A068UG681e-127A0A068UG68_COFCA; Uncharacterized protein
STRINGVIT_08s0007g00180.t013e-89(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19172463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.12e-44Dof family protein